Cagrilintide Amylin Analog (5mg)

164.99

+ Free Shipping

Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

Cagrilintide Amylin Analog (5mg) Description

Cagrilintide Amylin Analog (5mg) is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

Cagrilintide Amylin Analog (5mg) Information

Property Value
Peptide Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2
Molecular Weight 4409 g/mol
CAS Number 1415456-99-3
PubChem CID 171397054
Synonyms 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N

Cagrilintide Peptide Structure

Image showing Cagrilintide peptide structure

Source: PubChem

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.  This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide Amylin Analog (5mg)”

Your email address will not be published. Required fields are marked *

Shopping Cart
error: Content is protected !!